SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008085 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008085
Domain Number 1 Region: 875-982
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000498
Family cAMP-binding domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008085
Domain Number - Region: 616-738
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00235
Family Voltage-gated potassium channels 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008085   Gene: ENSTTRG00000008515   Transcript: ENSTTRT00000008530
Sequence length 1126
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_978:108160:186797:-1 gene:ENSTTRG00000008515 transcript:ENSTTRT00000008530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANVSFWVQKEGNQTDLLCGRSADYMPTKEHFPILVCSTVVLGGLLRAFLKNSEVIVLMIL
SLVGFLIGQLAYNFVEMHQVVYPLLRTPSFSIYCYFSPLIIFMAALNVDFYILKNVFWQV
MLTGLISFSTAFVVIGYVVLKFNKDSWDLQSCLLFSMTLGMTDPVHSVNSLKTIGISKMY
TDIIRGESMIICGFTSIVFGVFRSSILSISNYRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXEFLGMSGMVALVSVGLNLDSLSFKPRIELIIT
KFLMMFSSVYQHLIYTFFGIVIGCGEIKYLQFHTLVFMLILFATVNFVRLLTVVLVSPIL
RHSNYEYNWRWGIVIAWSGIKGVFSLLLAPDVHNLAEQKVESPQLFILYIQVISLMTMGI
NSYMMTYSARTLGLCAISLPRQMAMQNAIKHIQKIIQNRITLFKTEKILTNVNWTLVEEK
TKIEYIIPFPHVSCDKKVKEESPTDEVLIEEARLHVAIIQMSSFEKQCNDGVLSVEAART
LIGATKSYCHIQGKFMSIYDVSTYVRARSWLMKFKNILTFLEYHEDKTPLSLYGNNKFLI
FIYHIVFSEEFEYAGHILRIMYIYPMIMHLWPMARELNVSALILVNYYFVYLYLLESALK
ITILKSRYFHQHWNTLEFCIVLIGIVDIFCIYFVRLRPDHLVLIQFTVIMGYFRIIRFIP
LIKVLIPLLMNIVDVQIKKRLSLMYSITKGYVKSQEDTKFLIKQISSRKSINQXXXXXXX
XXXXXXXXXXXLIEHEGRDVVIALKTKQAIRNVIAKALKSLTFLWSRGIIDKHEGIEMNK
VLLSKIKSLNNFPMAIPPPTPDKYLHNIIWLENKDVLIEFFKERAKLACFDYGDVICKEG
EMPQGIYLIISGMAILQSSPPTFGIDRSLRADRESATRFTEYCTSGDIIGELSCLLKCEI
EYTAICETILQACFISLEDLYEGFDVFWPSLEYKIWLKLALSIAYQYFESSLIDEDLKFQ
KCVALNHAYVETLSSYNEMTIDNVNMKFVILVYGSVIDTKTEVPYLAPCILPKTCEQVEG
TSDLSKLLVIQAPAPAENNNNAKVMGSVNTVLEPRETITGREKMSW
Download sequence
Identical sequences ENSTTRP00000008085 ENSTTRP00000008085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]