SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008096 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008096
Domain Number 1 Region: 157-245
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.31e-19
Family Translation initiation factor IF3, C-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 78-144
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000523
Family Translation initiation factor IF3, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008096   Gene: ENSTTRG00000008546   Transcript: ENSTTRT00000008541
Sequence length 278
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1992:279679:283209:-1 gene:ENSTTRG00000008546 transcript:ENSTTRT00000008541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLLKRLTLQTIKTENTCIRRRLGKYVVQKTALAEPSHIASAPRLSCLIHAEAFSTED
TQDKREKKKKNETAFRNVGRKINERIIQVLDEKGNDLGPMHRANVIRLMAEQDLRLVPRD
PGAQPPQYQLMTGTQIYQERLRLRGMERAEPKPGPTLTKELTFSSNIGQHDLDTKSKQIQ
QWIEKKYKVQITIKKGKTTEEPENKMEEICNQILQTMPGIATFSSRPQPIRRGKAVMCVL
RPLSQKEDNACRSALGTQRGDALNRGNGNDGASNALHQ
Download sequence
Identical sequences XP_019792384.1.83887 XP_019792385.1.83887 ENSTTRP00000008096 ENSTTRP00000008096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]