SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008145 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008145
Domain Number 1 Region: 437-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.83e-72
Family Protein kinases, catalytic subunit 0.00000043
Further Details:      
 
Domain Number 2 Region: 276-398
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-35
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 61-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000244
Family I set domains 0.078
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008145
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008145   Gene: ENSTTRG00000008590   Transcript: ENSTTRT00000008591
Sequence length 939
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_150:114331:339219:-1 gene:ENSTTRG00000008590 transcript:ENSTTRT00000008591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGLALPLLCVPSVWAAAALLLCVSGTSXXXXXXXXXXXXXXXXXXXXXXXXXXXYFLN
FLEPVNNITIVQGQTAILHCKVAGNPPPSVRWENDAPVVQEPRRIIIRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTHSPNHNFQDDYHEDGFCQPYRGIACAR
FIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSR
APKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG
IPAERLGRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHHLTSADFPELGGGHAY
CRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPQDSSRMGILYILVPSIAIPLVIACLFFL
VCMCRNKQKASSSTPQRRQLMASPSQDVEMPLISQHKQAKLKEISLSTVRFMEELGEDRF
GKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEALLRARLQHPNIVCLLGVVT
KDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQIAAGME
YLSSHHVVHKDLATRNVLVYDKLTVKISDLGLFREVYSADYYKLTGSALLPIRWMSPEAI
MYGKFSVDSDIWSYGVVLWEVFSYGLQPYCGHSNQDVVEMVRSRQVLPCPDDCPAWVYAL
MIECWHEFPSRRPRFKDIHSRLRAWGNLSTYNSSGQTSGASNVTQTSSLSTSPVSNVSNT
RYGGPKQKAQPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPM
QMAPQQVPPQMVPKPGSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDTQNVPEDV
AQSPVQEAEEEEDGSVPETELLGDNDTLQMDESEVQLEA
Download sequence
Identical sequences ENSTTRP00000008145 ENSTTRP00000008145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]