SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008242 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008242
Domain Number 1 Region: 9-37,154-323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.34e-59
Family G proteins 0.000000017
Further Details:      
 
Domain Number 2 Region: 37-156
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.28e-43
Family Transducin (alpha subunit), insertion domain 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008242   Gene: ENSTTRG00000008695   Transcript: ENSTTRT00000008694
Sequence length 329
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2088:58032:344129:-1 gene:ENSTTRG00000008695 transcript:ENSTTRT00000008694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDKRDARQELKVLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAM
IRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRRE
YQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR
SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVI
LFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTC
ATDTENIRFVFAAVKDTILQLNLKEYNLV
Download sequence
Identical sequences ENSTTRP00000008242 ENSTTRP00000008242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]