SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008302 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008302
Domain Number 1 Region: 5-356
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.13e-41
Family Extradiol dioxygenases 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008302   Gene: ENSTTRG00000008769   Transcript: ENSTTRT00000008757
Sequence length 369
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3181:41084:42487:1 gene:ENSTTRG00000008769 transcript:ENSTTRT00000008757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPARRLCHIAFHAPAGLPLARDLQRLFGFQPMAVREADGWRQLALRSGDAVFLVNEGA
GPAEPLYGDPHHAVPSATNLCFDVADAGAAARALAALGCSVPVPVSVRDEQGTATYAVIS
SXXXXXXXXXXXXXXXXXXXXXXXXXVPSAPGPGWVSHVDHLTLACTPSSSPKLMRWFHD
CLGFHHLPLSPGEDPELGLEVAAESGPGGLRLTALRAPTGSAVPTLVLAESLLGVTSRQD
QVEQFLARNGGPGLQHVGLYTPNIMKATEGVVGAGGQLLTPPEAYYQQPGKEKQILAAGL
EPSLLARQGVLLDGDRGKFLLQVFTKSLFAEDTFFLELIQRQGATGFGQGNIRALWQSVQ
EQAARVQEA
Download sequence
Identical sequences ENSTTRP00000008302 ENSTTRP00000008302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]