SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008324 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008324
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.63e-74
Family Carbonic anhydrase 0.0000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008324   Gene: ENSTTRG00000008780   Transcript: ENSTTRT00000008779
Sequence length 290
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2515:27796:31396:1 gene:ENSTTRG00000008780 transcript:ENSTTRT00000008779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHWCYQNQVKPSNYTCLGPDQWGDSCQNDRQSPINIATAKTLLDPNLGPFSFSGYDKKQK
WXXXXXXXXXMVLLGAEASIAGGGLAARYRAKQLHLHWSKVLDWGSEHSFDGDRFAMEMH
VVHEKEKGTSRNTNQNQDPKDEIAVLAFMVEAGSENVNFQPLVQALSDIPNPNMNTMLKD
NISLFDLLPKMELRHYFRYLGSLTTPGCDEKVWTVFQEPIQLHKDQILAFSQKLYYDNEK
KLKMTDNVRPLQPRGQRQVLRSQAPGRLLPLPLPALLAPVLTCLTAGFLR
Download sequence
Identical sequences ENSTTRP00000008324 ENSTTRP00000008324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]