SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008339 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008339
Domain Number 1 Region: 91-310
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.28e-68
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 357-496
Classification Level Classification E-value
Superfamily Nudix 2.03e-26
Family MutY C-terminal domain-like 0.000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008339   Gene: ENSTTRG00000008783   Transcript: ENSTTRT00000008794
Sequence length 548
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3181:43365:51159:-1 gene:ENSTTRG00000008783 transcript:ENSTTRT00000008794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPVPRLYSQCSIMRKPRAAVGSRSRCRKQASSQEGREKRALSSSQAKPSAPDGTIPEFS
EAPAGLARQQEEVRLQAPVSPYHLFRDTAEVTVFRKSLLSWYDREKRDLPWRRRVEGEVD
LDRRAYAVWVSEVMLQQTQVATVIDYYNRWMQKWPTLQDLASASLEEVNQLWAGLGYYSR
GRRLQEGARKVVEELGGHMPRTAETLQWLLPGVGRYTARAIASIAFGQATGVVDGNVVRV
LCRVRAIGADPSSTLVSQQLWSLAQQLVEPARPGDFNQAAMELGATVCTPQRPLCSQCPV
QSLCRAHQRVEREQLSASRSPPGSRDVEECAPNTGQCQLCAPPTEPWDQTLGVANFPRKV
SRRPPREECSATCVLEQPRALGGARILLVQRPNSGLLAGLWEFPSVTAEPSGQHQRKALL
QKLQSWVGPVPATRLRHLGQVVHTFSHIKLTYQVYGLALEEQTPVAIVPPGARWLTREEF
HTAAVSTAMKKVFRVYEGQQPGTCKGSKRSQVSTLSRWKKPSAGQQVLDSFFRPHIPADA
PSLNSATQ
Download sequence
Identical sequences ENSTTRP00000008339 ENSTTRP00000008339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]