SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008645 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008645
Domain Number 1 Region: 62-333
Classification Level Classification E-value
Superfamily Radical SAM enzymes 8.5e-76
Family MoCo biosynthesis proteins 0.0000046
Further Details:      
 
Domain Number 2 Region: 579-629
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 6.15e-17
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008645   Gene: ENSTTRG00000009122   Transcript: ENSTTRT00000009118
Sequence length 632
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1809:48924:83217:-1 gene:ENSTTRG00000009122 transcript:ENSTTRT00000009118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPVSRMLRRVLRSSVRSCSSGALVTQPHPGEPSQPAVEVPSGRRRFLREHAAPFSAF
LTDSFGRRHSYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVD
KIRLTGGEPLIRPDVVDIVAQLHQLEGLRTIGITTNGINLARLLPQLQEAGLSTINISLD
TLVPAKFEFIVRRKGFRKVMEGIHKAIELGYSPVKVNCVVMRGLNEDELLDFVALTEGLP
LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTLRQQWPELEKLPEEESSTAKAFKIPGFRGR
VSFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEEELLRIIGAAVG
RKKRQHAGMFNISQMKNRPMILIELFLMCQGSPAVSISFDSLHVGLRHRVSFSSXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPTGVEMEALTSAAVAALAL
YDMCKAVSRDIVLAEIKLVSKTGGQRGDFHRT
Download sequence
Identical sequences ENSTTRP00000008645 ENSTTRP00000008645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]