SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008844 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008844
Domain Number 1 Region: 104-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-43
Family G proteins 0.0000000294
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 8.9e-32
Family Transducin (alpha subunit), insertion domain 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008844   Gene: ENSTTRG00000009327   Transcript: ENSTTRT00000009326
Sequence length 282
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3549:34924:70062:-1 gene:ENSTTRG00000009327 transcript:ENSTTRT00000009326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLVDAREKLHIPWGDTSNHLNGDKLMAFDTRTPLTAQGIVETRVFLQYLPAIRALWAD
SGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKN
VPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETI
VNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRR
DQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
Download sequence
Identical sequences ENSTTRP00000008844 XP_012390503.1.21590 XP_019794228.1.83887 ENSTTRP00000008844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]