SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008880 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008880
Domain Number 1 Region: 3-342
Classification Level Classification E-value
Superfamily ARM repeat 1.85e-30
Family Armadillo repeat 0.072
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008880
Domain Number - Region: 353-411
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0245
Family VPS28 N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008880   Gene: ENSTTRG00000009364   Transcript: ENSTTRT00000009367
Sequence length 498
Comment pep:known_by_projection scaffold:turTru1:scaffold_115718:4206:33620:1 gene:ENSTTRG00000009364 transcript:ENSTTRT00000009367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEDTKKIQGMKTDLNLLLECLKYQMDNAFSQKEALVTIHSICQQNSNAGLYFREIGGL
MFVKDLAKSSEHSMVKEAALYTLGAVAEQNFYCQQTLCTSELFEDLTWFLSNNDSNTNLK
RMSVYVILVLVSNNRTGQTLVRETGCISVLSQLFKTVLSKYELNLSDENVFQSYQLWSSV
CSTLCVCVNNPQNDENQMLCSSLFPHANDWLINCTKPEIIRPICSFIGLTLANNTYVQKY
FISVGGLDILSQVLVQLESDSHKTLSSAKLAVVVTKTVDACIADNPTFGVVLSKYHIVSK
LLALLLHESLDSGEKFSIILTVGHCTEDCAEKLSLSLGEYSFDENEGQLKDINMKEKNLE
DYWKKAKEILHRIEQLEREGNEERVQREKYKDYVSSMNINIQNTLKHLHADSSGGGSKAE
DRDKSQSRKLQSYKSHEVMSKACTNDDQMKTLLKSANPVNACYRESKQNKTLCKANSSCN
QNLREETTFEKKNFVSQS
Download sequence
Identical sequences ENSTTRP00000008880 ENSTTRP00000008880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]