SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008933 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008933
Domain Number 1 Region: 1198-1353,1392-1471
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1522-1770
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-36
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 130-155,210-275,349-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-16
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 710-733,799-856,890-937
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000753
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008933   Gene: ENSTTRG00000009385   Transcript: ENSTTRT00000009425
Sequence length 2011
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3081:4200:90059:-1 gene:ENSTTRG00000009385 transcript:ENSTTRT00000009425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFLLPRVTSSFRRFTRESLAAIEKRMAEKQARGSAASQESRDGLPEEEVPQPQLDLQA
SKKLPDLYGNPPQELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI
RRAAVKILVHSLFSMLIMCTILTNCVFMAQRDPPPWTKYVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTVLSGTNGSVEAGGLW
ESLDLYLDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAWAF
LALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQNQA
TIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAAVISHEGRSKQRKQM
SSGSEECGDDRFPKSDSEDGPQAVNHLSITHGLSRTSLKPRSSHGSIFTFRRRDVGSETF
ADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAVDCNGVVSL
LGGDESTYSGSRLRPMMLEHLDTTTPSEEPGRPQMLTPQAPCVDGFEEPGERRRTLSAVS
VLTSVLEELESHRKYPPCWNRFAQRYLIWECCPLWMSIKQRVKIMVMDPFADLTITMCIV
INTLFMALEHYNMTTEFEEMLQVGNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAI
IVFIFAVVGMQLFGKNYSELRHRISDPGVLPRWHMMDFFHAFLIIFRILCGEWIETMWDC
MEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDGEMNNLQLALARI
QRGLRFLKRTTWDFCCGLLQRRAQKPAALATQGQLPGCITTSSPPPPSETEKALPARKET
RFEEGQRPGQGTPGDPEPVCVPIAVAESDTDDQEEDEENSLSTEEESSKQQESQPMSGSP
EALPEPRSWSQVSETTSSGAEASAAQADLRQQQRTEAPAPGCSETHENSYSEGSTADMTN
TVDLLEQIPDLAEDVKDPEDCFTKGCVQRCPCCTVDTTQAPGKVWWRLRKTCYRIVEHSW
FETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYIFVLEMLLKWVAYGFKKY
FTNAWCWLDFLIVGVSLISLVANALGFAEMGPIKSLRTLRALRPLRALSRFEGMRVVVNA
LVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKSDCMS
FNVTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEYNLYM
YIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKP
QKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKVNILAKINLL
FVAIFTGECIVKMAALRYYYFTNSWNIFDFVVVILYIVGTVLSDIIQKYFFSPTLFRVIR
LARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFAYVKWEA
GIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRGNCGSPA
VGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEAT
QFIEYSALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESG
EMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSASIIQRAFRRHLLRRSMKHASF
LFRQQAGGSGLSEEDAPEQEGLIAYMMNENFSQRLVPPSSSSISSTSFPPSYDSVTRATS
DNPQARASDYSPSEDLADIPPSPDRDRESVV
Download sequence
Identical sequences ENSTTRP00000008933 ENSTTRP00000008933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]