SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009076 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009076
Domain Number 1 Region: 373-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.71e-62
Family Eukaryotic proteases 0.00045
Further Details:      
 
Domain Number 2 Region: 195-306
Classification Level Classification E-value
Superfamily Kringle-like 1.3e-23
Family Kringle modules 0.0016
Further Details:      
 
Domain Number 3 Region: 36-88
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000002
Family Fibronectin type II module 0.0068
Further Details:      
 
Domain Number 4 Region: 95-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009076   Gene: ENSTTRG00000009576   Transcript: ENSTTRT00000009576
Sequence length 618
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2447:215643:229166:-1 gene:ENSTTRG00000009576 transcript:ENSTTRT00000009576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGVLLVSLESAVLTPPWKAPMEHKFIESERTVVLTVTGEPCHFPFQYHWQLYHK
FIHRGWPGRPWCATTPNFKKDQRCGYCLEPKKVKDHCSKHKPCQKGETCVNMPNGPHCIC
PDHFTGKHGQREKCFEPQLLWFLQENEIWHRLELAGVAKCQCNGPNAQCKPLASQVCRTN
PCLNGGSCLQAEGHRLCSYPTGYAGRLCEVDHKANCYDDRDHGLSYRGVARTKLWGAPCQ
PWASEATYWNVTAEQALNGRLGDHAFCRNQDNDTRPWCFVWRDDRLSSNYCRLALCQAPA
PTTPQIPPPIRISSEHQYFPLPSLSALQKPQSTTQTPLRPLTSGCWCSPPEQRTPLPSAG
PAGCGRWLHKRLSSLSRVVGGLMALPGAHPYIAALQGQNFCTGSLIVPCVLTAAHCLQNR
PAPEELTVVLGQDRHNQSYEQCQTLAVRAYPLHEAFSLITYQHDLALVRLQESAEGCCAH
PSPFVQPVCLPSSAALPAESEAALCEVAGWGHQLEGPGYSSFLQTQVPLIHPERCSAPDV
HGAAFIPGMLCAGFLEGGTDACQGNSRGPLVCEDETAERQLILRGIVSWGSGCGDHHMPG
VYTDVANYLAWIREHTAS
Download sequence
Identical sequences ENSTTRP00000009076 ENSTTRP00000009076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]