SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009150 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009150
Domain Number 1 Region: 175-358
Classification Level Classification E-value
Superfamily vWA-like 0.0000000148
Family Integrin A (or I) domain 0.037
Further Details:      
 
Domain Number 2 Region: 663-771
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000761
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009150   Gene: ENSTTRG00000009607   Transcript: ENSTTRT00000009655
Sequence length 1223
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2162:73900:290537:1 gene:ENSTTRG00000009607 transcript:ENSTTRT00000009655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLAAEELGVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVE
ASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLN
SVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVV
ILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISMLTVADTVRTCSLDQCYKTFLSPATS
ETKRKMSTFVSSVKSLDSPTQHAVGFQKAFQLIRSTNNSTKFQANTDMVIIYLSAGITSK
DSSEEDKKATLRVISEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVL
DRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSK
PCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEP
PLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYA
WKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLE
SPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHV
TDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLIS
LTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQD
GGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCN
SFSDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCAC
SMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTAIDPG
LQEALHQCVNSRCSQRMESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAK
SPYVDDMGAIGDEVVTLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSP
LAAQEMSVRMSNLENDRDERDDDGHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGT
ESDHGYSTMSPQEDSENPPCTNDPLSAGVDVGNHDEDLELDTPPQTAALLSHKFHHYRLH
HPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences ENSTTRP00000009150 ENSTTRP00000009150 XP_004281664.2.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]