SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009183 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009183
Domain Number 1 Region: 441-580,697-857
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 6.93e-114
Family Substrate-binding domain of HMG-CoA reductase 0.0000000000851
Further Details:      
 
Domain Number 2 Region: 583-699
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 7.32e-44
Family NAD-binding domain of HMG-CoA reductase 0.000000622
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000746
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009183   Gene: ENSTTRG00000009654   Transcript: ENSTTRT00000009690
Sequence length 884
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1782:105279:119491:1 gene:ENSTTRG00000009654 transcript:ENSTTRT00000009690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHDLFVASHPWEVIVGTVTLTICMMSMNMFTGNDKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPADNSKVSLGLDENVSKRIEPS
VSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVTQKKV
ADDCCRRDPVLVRNDQKFHAVEEEARINRERKVEVIKPLVAETDTSNRATFVVGNSSLLN
TSLELETQEPEIELPMEPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYKLETL
METYERGVSIRRQLLSRKLPEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGPL
CLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRILADGITRGPVVRFPRACDSAE
VKAWLETPEGFTVIKEAFDSTSRFARLQKLQMSVAGRNLYIRFQSKSGDAMGMNMISKGT
EKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAIIPAKVVREVLKTT
TEAMIEVNINKNLVGSAMAGSIGGFNAHAANIVTAIYIACGQDAAQNVGSSNCITLIEAS
GPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCG
TVMAGELSLLAALAAGHLVRSHMIHNRSKINLQDFQGTCTKKAA
Download sequence
Identical sequences ENSTTRP00000009183 ENSTTRP00000009183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]