SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009207 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009207
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-24
Family FKBP immunophilin/proline isomerase 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000009207
Domain Number - Region: 192-249
Classification Level Classification E-value
Superfamily EF-hand 0.000101
Family Calbindin D9K 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009207   Gene: ENSTTRG00000009719   Transcript: ENSTTRT00000009714
Sequence length 255
Comment pep:known_by_projection scaffold:turTru1:scaffold_91159:266072:274822:-1 gene:ENSTTRG00000009719 transcript:ENSTTRT00000009714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGIMHFLFRLIIFVYLWGIFTAQGQKAEESIEEVKIEVLHRPENCSNTSKKGDVLNAHY
DGFLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIGMTDMCPGEKRKLIIPPSFAYG
KEGYGILEEVFPVRNIFACHRAPLHVLKCMLLVINSTCXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDADNDRQLFKEISHYLKKEFEKDEKPRDKSYQNAVLEDIFKKNDHDGDG
FISSKEYNVYQHDEL
Download sequence
Identical sequences ENSTTRP00000009207 ENSTTRP00000009207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]