SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009261 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009261
Domain Number 1 Region: 55-235
Classification Level Classification E-value
Superfamily HAD-like 3.43e-49
Family NLI interacting factor-like phosphatase 0.0000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009261   Gene: ENSTTRG00000009770   Transcript: ENSTTRT00000009768
Sequence length 244
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2224:130894:136575:-1 gene:ENSTTRG00000009770 transcript:ENSTTRT00000009768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLSQVK
RKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEV
VSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLS
SIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQ
HRLW
Download sequence
Identical sequences F1SFU2 L8IZE5 Q1RMV9 W5PN95
ENSTTRP00000009261 NP_001039491.1.59421 NP_001039491.1.76553 XP_004012691.1.66739 XP_004266981.1.21590 XP_005693543.2.57651 XP_005890015.1.15283 XP_006060214.1.26621 XP_007100744.1.24612 XP_007166521.1.59432 XP_007457813.1.90284 XP_010994853.1.51371 XP_017522492.1.32401 XP_019836742.1.53367 ENSOARP00000011921 ENSTTRP00000009261 ENSBTAP00000025896 ENSSSCP00000022912 ENSSSCP00000022912 ENSBTAP00000025896 9913.ENSBTAP00000025896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]