SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009267 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009267
Domain Number 1 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.35e-38
Family DNA repair glycosylase, N-terminal domain 0.000000587
Further Details:      
 
Domain Number 2 Region: 136-316
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.44e-36
Family DNA repair glycosylase, 2 C-terminal domains 0.000000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009267   Gene: ENSTTRG00000009774   Transcript: ENSTTRT00000009774
Sequence length 412
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3269:567248:579169:1 gene:ENSTTRG00000009774 transcript:ENSTTRT00000009774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARSLLQRSMRHRTLASVPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEHLYCTVYRGDKGRVGRPTLEELKAVRQYFRLDVSLAQLYHHWSSVDPHF
QEVAQKFQGVRLLQQDPIECLFSFICSSNNNIARITGMMERXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPQVEAQLRKLGLGYRARYVSASARAILEERGGLPWLQQLRKAPYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDVHVWQIAQCDYSWHPTTKGPSPQANKELGSFF
RSLWGPYAGWAQANLLGDTFDGHQLLSPLIFCQDYLREGPSAERGDSRGGEQLPSSLSSI
PCGLRDHPQTKEMDEPPSITHSPPGARGTWPIRVVYPLATVIGPVIARLLAL
Download sequence
Identical sequences ENSTTRP00000009267 ENSTTRP00000009267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]