SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009357 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000009357
Domain Number - Region: 111-154
Classification Level Classification E-value
Superfamily Tetraspanin 0.000549
Family Tetraspanin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009357   Gene: ENSTTRG00000009870   Transcript: ENSTTRT00000009868
Sequence length 204
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3564:582224:615785:1 gene:ENSTTRG00000009870 transcript:ENSTTRT00000009868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA
LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNEEQQGQLLEVGWNNTASARN
DIQRNFNCCGFRSFNPNDTCLASCVKSSHQCSPCAPIIGKYAGEVLRFVGGIGLFFSFTE
ILGVWLTYRYRNQKDPRANPSAFL
Download sequence
Identical sequences ENSTTRP00000009357 XP_019783780.1.83887 ENSTTRP00000009357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]