SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009435 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009435
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily PRTase-like 1.26e-39
Family Phosphoribosyltransferases (PRTases) 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009435   Gene: ENSTTRG00000009954   Transcript: ENSTTRT00000009948
Sequence length 209
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3447:236192:258810:1 gene:ENSTTRG00000009954 transcript:ENSTTRT00000009948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLK
GGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKN
VLIVEDIIDTGKTMQTLLSLVKQHNPKMVKVASLLVKRTPRSVGYRPDXXXXXXXXXXXX
XXXXXXXXXXXXXXHVCVISETGKAKYKA
Download sequence
Identical sequences ENSTTRP00000009435 ENSTTRP00000009435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]