SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009493 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009493
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.79e-43
Family Nip7p homolog, N-terminal domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009493   Gene: ENSTTRG00000010012   Transcript: ENSTTRT00000010010
Sequence length 180
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2558:121788:123545:1 gene:ENSTTRG00000010012 transcript:ENSTTRT00000010010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences A0A287D058 G1QF14 L5KUB3 L9JJ84 S9X993
XP_004273256.1.21590 XP_004319746.1.83887 XP_005318425.1.77405 XP_006091215.1.53796 XP_006156984.1.99106 XP_006180639.1.101512 XP_006203805.1.17985 XP_006909872.1.64745 XP_007129088.1.24612 XP_007449990.1.90284 XP_010960849.1.22495 XP_010977518.1.51371 XP_012597893.1.48125 ENSSTOP00000011532 ENSMICP00000008791 ENSVPAP00000003708 ENSMICP00000008791 ENSVPAP00000003708 ENSTTRP00000009493 ENSMLUP00000022297 ENSTTRP00000009493 ENSMLUP00000019926 ENSSTOP00000011532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]