SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009502 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009502
Domain Number 1 Region: 42-197
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.14e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 202-348
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.23e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009502   Gene: ENSTTRG00000010019   Transcript: ENSTTRT00000010019
Sequence length 409
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1416:232098:238130:-1 gene:ENSTTRG00000010019 transcript:ENSTTRT00000010019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARLRPRLWFCLLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTL
GASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQ
WPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYE
SKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTFS
DVLIFLDREPDRLRAFQVIETQDPPRRLALTPAHLLFTANNHTEPATHFRATFASQVQPG
QYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVASCFAAVAHQLAQLSFW
PLRLFHSLAWGSWTPGEGVHWYPQLLYRMGRLLLEEGSFHSLGMAGAGS
Download sequence
Identical sequences ENSTTRP00000009502 ENSTTRP00000009502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]