SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009621 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009621
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.15e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.0000000000144
Family YccV-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009621   Gene: ENSTTRG00000010148   Transcript: ENSTTRT00000010144
Sequence length 368
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_752:28385:36050:-1 gene:ENSTTRG00000010148 transcript:ENSTTRT00000010144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVARRALTVGSRWWSRSLTGARGPRPLSAAGGAGTFPPVATTTTRRHLSSRNRPEGK
VLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASVAPEKAENPAG
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDNDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHW
Download sequence
Identical sequences XP_004314077.1.83887 ENSTTRP00000009621 ENSTTRP00000009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]