SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009628 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009628
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.09e-101
Family Carbonic anhydrase 0.0000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009628   Gene: ENSTTRG00000010154   Transcript: ENSTTRT00000010152
Sequence length 264
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2178:33451:42058:1 gene:ENSTTRG00000010154 transcript:ENSTTRT00000010152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHHGWGYGHNDGPSHWHKLYPIARGDRQSPINIVSRKAVYSPSLRTLDLSYESCTSLS
IANNGHSVQVDFNDSDDRSVVTGGPLDGPYRLRQLHFHWGKKHSEGSEHTVDGKSFPSEL
HLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSC
FNPKYLLPASRHYWTYPGSLTTPPLTESVTWIVLREPISISERQMEKFRSLLFTTEEDER
IHMVNNFRPPQPLKGRVVKASFWA
Download sequence
Identical sequences ENSTTRP00000009628 ENSTTRP00000009628 XP_004280937.1.21590 XP_004311056.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]