SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009742 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009742
Domain Number 1 Region: 142-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.11e-24
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 7-34,74-140
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009742   Gene: ENSTTRG00000010273   Transcript: ENSTTRT00000010268
Sequence length 396
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_380:560253:597701:1 gene:ENSTTRG00000010273 transcript:ENSTTRT00000010268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTFVKYLLHRAKRGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSY
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGAGGAGGSAHTTDTASSTAAAGGGGFRN
VYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPS
HRCLCSGAQRSAISSVSTGLHSLSTFRSLMKRRSSV
Download sequence
Identical sequences ENSTTRP00000009742 ENSTTRP00000009742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]