SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009747 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009747
Domain Number 1 Region: 63-115
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000104
Family Kringle modules 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009747   Gene: ENSTTRG00000010276   Transcript: ENSTTRT00000010273
Sequence length 264
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2507:460715:470214:-1 gene:ENSTTRG00000010276 transcript:ENSTTRT00000010273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWLQTILVVSNMLLAKAYGSGGCFWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXAGNHSYCRNPDQDPRGPWCYVSGEAGSPEKRPCKDMRCPETTFQGLPTSTTETEEV
SEVPGGDEVQVFAPANTLPAQSEAAAVQPVIGISQRVRVNSKEKKDLGTLGYVLGVTMMV
IIIGIGAGIVLGYTYKRGKDLKEQHERKVCEREMQRITLPLSAFTNPNCEIVDEKTIVVH
ASQTPVDLQEGSAPLMGQAGTPGA
Download sequence
Identical sequences ENSTTRP00000009747 ENSTTRP00000009747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]