SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009802 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009802
Domain Number 1 Region: 89-197
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.49e-35
Family Frataxin-like 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009802   Gene: ENSTTRG00000010336   Transcript: ENSTTRT00000010332
Sequence length 211
Comment pep:known_by_projection scaffold:turTru1:scaffold_91565:5488:26039:-1 gene:ENSTTRG00000010336 transcript:ENSTTRT00000010332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAAASLLPRSAPPGSAQARAGAPRPTKDSRLYGCRGLRTGTAAAGTPSQPSLSL
CCLNQMLNVKKQWVCWMNLRTTGTLGDAGPLDDTTYERLVEETLDSLAEFFEDLADKPYT
CEDYDVSFVSGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSGPKRYDWTGRNWVYSHDGV
SLHELLATELTQALKTKLDLSSLAYSGKGTC
Download sequence
Identical sequences ENSTTRP00000009802 ENSTTRP00000009802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]