SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009865 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009865
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.47e-31
Family Ribosomal protein S14 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009865   Gene: ENSTTRG00000010408   Transcript: ENSTTRT00000010399
Sequence length 128
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1978:663977:683659:-1 gene:ENSTTRG00000010408 transcript:ENSTTRT00000010399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASTLGSLLRTVRQVVPSSASGQVRSYYVDWKMLRDVKRRKMAYEYADERLRINSLRKN
TILPKDLQEVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQL
SGVQRAMW
Download sequence
Identical sequences XP_004269833.1.21590 XP_004327458.1.83887 ENSTTRP00000009865 ENSTTRP00000009865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]