SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009871 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009871
Domain Number 1 Region: 274-324
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000688
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009871   Gene: ENSTTRG00000010402   Transcript: ENSTTRT00000010405
Sequence length 1106
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2702:561566:622092:1 gene:ENSTTRG00000010402 transcript:ENSTTRT00000010405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGGKSQDSRRRQPKDEALGKDSAEMWSRKYQLRSKYVQTSNSEPQDQNRVSKDLITVVQ
EMKKYFPSERQSKPSTLDALNYALRCVHSVQANSEFFQILNQNGAPQADVTMYSLEELAA
VASEHTSKNTDTFVAVFSFLSGRLVHVSEQAPLILHCKKEFLESSHFVELLAPQDVRVFY
THTAHAQLPFWNNWTQRAASRYEFAPVKSFFCRIRGGEAQELRQPYCPFRIIPYLIHVHS
SARPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEIDERAVPLLGYLPQD
LIGTSILTYLHPEDRSLMVAIHQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFV
PWSRKVSFIIGRHKVRTSPLNENVFATGIKKMNSNDKDITELQEQIHRLLLQPVHGSASS
GYGSLGSSGSQEHHLSIASSSESSEHCMEEVQKAPLTLQQVYASVNKIKNLGQRLYIESR
AKSPKKQVMETDPGQRGGESAEQKTFSSFQTLKNNSMYPESCEDLRRCQHSPSYQQINCI
DSVVRYLKSYDIPALKRKCISCTNTTSSSSEEDGQSHRADDVQALQAVSQIPAVPTSEMP
ANGRSTDAEGGAPQALTKEALSLDGRQCSCSSTVVHMPPLESAELGILPCEPWTLSTHPA
ALASEQFKHTGLTKAVLSAHTQKEEPSYVDQFRDRILSSPYGSYLQQESRSKPTYSDVQG
DSASKPTRSAGCRKGKHKRKKLLMWSDSKGTKDDFCPHLIGETQDGQPWCPSSTSSPYAS
GPLLQAAVVVPSQAPCLVQALPLPTMTSLGRERAASETALQSLPEPPFPNGLQSFPALPS
ACLGTFMNIFLHDAPICPLLLPPFSPYPFLGAAGSSEIPASVSAVPPNPGPPSSAISQRS
GEGKWGTQNEGHPLINSKSSSPLQLDLLQENRPRSCASPEAEYHFTTSELSTVSLHEASP
PGAGSAAAGSSGSSINFATSDYSSEIFQNGQQSQDVQKKETFPNLAEESIWRMIEQTPEC
ILMTYQVPERVKEIVLKEDLENLESMRRRQPQFSHGQREELANVRSWIQSQTIPQEIDIQ
GCVTCENGDSAGDAAESCRPDPAESS
Download sequence
Identical sequences ENSTTRP00000009871 ENSTTRP00000009871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]