SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009905 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009905
Domain Number 1 Region: 2-468
Classification Level Classification E-value
Superfamily ALDH-like 8.64e-165
Family ALDH-like 0.000000000000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009905   Gene: ENSTTRG00000010439   Transcript: ENSTTRT00000010442
Sequence length 468
Comment pep:novel scaffold:turTru1:scaffold_112707:18843:36659:-1 gene:ENSTTRG00000010439 transcript:ENSTTRT00000010442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHDSVSKKTFPTINPSTGDVICHVAEGDKXXXXXXXXXXXXXXXXXXXXXXMDA
SKRLLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK
TIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL
YVANLIKEAGFPPGVVNIVPGFGPTAGAAVASHEDVDKVAFTGSTEVGHLIQTAAGNSNL
KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYTEFVERS
VARARSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQ
PTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYL
SQALQAGTVWVNCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKT
Download sequence
Identical sequences ENSTTRP00000009905 ENSTTRP00000009905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]