SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009935 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009935
Domain Number 1 Region: 420-904
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-144
Family ALDH-like 0.00000000255
Further Details:      
 
Domain Number 2 Region: 8-208
Classification Level Classification E-value
Superfamily Formyltransferase 1.83e-51
Family Formyltransferase 0.00000000372
Further Details:      
 
Domain Number 3 Region: 212-314
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 0.000000000000381
Family Post formyltransferase domain 0.000082
Further Details:      
 
Domain Number 4 Region: 332-416
Classification Level Classification E-value
Superfamily ACP-like 0.00000302
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009935   Gene: ENSTTRG00000010472   Transcript: ENSTTRT00000010474
Sequence length 905
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_881:76118:120496:-1 gene:ENSTTRG00000010472 transcript:ENSTTRT00000010474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAPPAAMKIAVIGQSLFGQEVYCHLREEGHEVVGVFTVPDKDGKADPLGLKADKDGVPV
FKFPRWRARGQALPNVVATYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRH
RGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEILPDDTVSTLYSRFLFPEGV
KGMVQAVKLIAEGRAPRLPQPEDGATYEGIQKKETAQINWDQPAEAIHNWIRGNDKVPGA
WTEACGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLVKSIQ
LEDGKMIPASQLFRGADSTGLELTEEDLVTAEAVRGAWKRILPNVVEVEDSTDFFKSGAA
SLDVVRLVEEVKELCDGLELENEDIYMATTFGDFIQLLVRKMRGDNKESKCVIDHVEKTV
NKLTLRMPHQLFIGGAFVDAEGAKTYETINPTDGSVICQVSLAQVSDVDKAVAAAKDAFE
HGLWGKISARDRGRLLYLADLLQQQELATIEALDAGAVYTLALXXXXXXXXXXXXXXXXX
XXXXXGATIPINQARPNRNLTMTRKEPIGVCGIVIPWNYPLMMLSWKMAACLAAGNTVVI
KPAQVTPLTALKFAELTLKAGIPKGVINLPGSXXXVGQRLSDHPDVLKIAFTGSPEVGKR
IMKSCALSNVKKVSLELGGKSPLIIFADCDLRKAVQMGMSSVFFNKGENCIAAGRLFVED
SIHDQFVQRVVEEVGKMKIGSPLDRDTSHGPQNHQAHLQKLVEYCQRGVKEGATLVCGGN
QVPRPGFFFEPTVFTDVEDHMFIAREESFGPIMIISRFASGDVDAVLSRANATEFGLASG
VFTRDISKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKT
VTFEY
Download sequence
Identical sequences ENSTTRP00000009935 ENSTTRP00000009935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]