SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010100 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010100
Domain Number 1 Region: 65-115
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000981
Family LEM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 317-380,408-453
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000311
Family Ankyrin repeat 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010100
Domain Number - Region: 219-254
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0241
Family N-terminal domain of RNase HI 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010100   Gene: ENSTTRG00000010654   Transcript: ENSTTRT00000010653
Sequence length 933
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3220:89040:114588:-1 gene:ENSTTRG00000010654 transcript:ENSTTRT00000010653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWPRLAAAEWAALAWELLGASVLMIAVRLVRRLDRRPRGLGRSGPPDRPCAAAGPVPDP
GEMTMDTILARLKLLNPDDLREEVIKAGLKCGPITSTTRFIFEKKLARALLEHSTLPSHP
PDHATAGAPALGQDTQRVVKSAVGSPAERVSFSEDRDFGYSVGLNPPEEDAVTSETCSVP
FSALAGVGSHEAMLRASAEPPLYYGVCPAYEDAPARNERIHVYEDKKEALQAVKMIKGSR
FKAFTSREDAEKFARGTCDYFPSPSKTSSPLSPVKTVPLFSSGGLRDGLYLSDSETASKE
RANSYKSPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMH
VAAKENQAALCQLTLETLENPEFMRLMYPDDEPHMLEKRICYVVDLYLNTPDRVGYDTPL
HFACKFGNADVVNVLSSHPLIVKNPRNKYDKTPEDXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEDFR
RLWKTPPREKAGFFHSVRKSDPERGIERVGRQLAHELGYPWVEYWDFLGCFVDLSSQAGL
QKLEEYLTQQEVGKKTQQDMGENAACLQEDASALGSNSISVRAFLDEDDDMSLEEIKNRQ
NTARNNTQPTVAAFGDSGCDILPLEQKTDLIEASAPTSPRSSKNGFCSPPSDSKTLGGKR
PKAPSGEDAFLSPVSGLTVEFDKLNLQNLQSSFSNKTPRPTVKTRDKRILTSRVNPAESD
MLGPLAADKLGNDQGRTEHGMSAGMADMCLDPDSPTQEARHGGTKESVQSLFLFGEEPSK
LDRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWPSPSLKGKVKSQLPDIGGPP
SGGSPGRCSPGRYSPARRGHLHRMARLAQLATL
Download sequence
Identical sequences ENSTTRP00000010100 ENSTTRP00000010100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]