SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010157 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010157
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-55
Family GHMP Kinase, N-terminal domain 0.0000000123
Further Details:      
 
Domain Number 2 Region: 227-383
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.73e-41
Family Mevalonate kinase 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010157   Gene: ENSTTRG00000010711   Transcript: ENSTTRT00000010711
Sequence length 396
Comment pep:known_by_projection scaffold:turTru1:scaffold_113858:4712:23479:-1 gene:ENSTTRG00000010711 transcript:ENSTTRT00000010711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEVLLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGKVGLNLPNIGIQR
VWDVAKLQMLDTSFLKQGDVTALTPEQMEKLKEVAGFPEDCADHEHLAVLSFLYLYLSIC
QSQRALPSLDIAVWSELPTGAGLGSSAAYSVCLAAALLTACKEIPNPLKDGEAASRWTEE
SLELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLNRPPALKILLTNTKVP
RSTKALVAGVRSRLLKFPEIVAPLLTSIDAISLECERLLGEMAAAPAPEHYLVLEELIDM
NQHHLNALGVGHASLDRLCQVTMAHGLHSKLTGAGGGGCGITLLRPDLERPEVEAMKQAL
TSCGFDCWETSIGAPGVSVHTAASLDAPVRQALDGL
Download sequence
Identical sequences ENSTTRP00000010157 ENSTTRP00000010157 XP_019806005.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]