SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010214 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010214
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.37e-79
Family Glutamine synthetase catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 2.35e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010214   Gene: ENSTTRG00000010781   Transcript: ENSTTRT00000010771
Sequence length 373
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1407:53293:58492:1 gene:ENSTTRG00000010781 transcript:ENSTTRT00000010771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDCEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRI
MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFAVTEALIRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences XP_004269878.1.21590 XP_019773986.1.83887 ENSTTRP00000010214 ENSTTRP00000010214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]