SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010326 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010326
Domain Number 1 Region: 90-281
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.42e-46
Family Alanine racemase-like, N-terminal domain 0.000000417
Further Details:      
 
Domain Number 2 Region: 246-432
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.85e-23
Family Eukaryotic ODC-like 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010326   Gene: ENSTTRG00000010888   Transcript: ENSTTRT00000010891
Sequence length 476
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1668:19329:52533:1 gene:ENSTTRG00000010888 transcript:ENSTTRT00000010891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGCSEADFVMVEEGFSTRDLEQLTLGSQVTTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEMELVQHIGVPASKIIYANPCKQIAHIKY
AAKHGVRLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSRSRLSLKFGVSLKSCRQLLE
DAKRNHVEVVGVSFHIGSGCPDPQAYARSIADARLVFEMGAELGHRMHILDLGGGFPGVE
GAKVRFEEISSVVNSALDLYFPEGCGVDILAKLGRYYVTSAFTLAVSIIAKKEVLLEQPG
REATVPTPHAACAAPPPPLPAEENGSAPKTILYQLSEGEYGIFNSVLFDNTCPTPILPKK
PSTEQPLYSSSLWGPVINGCDCIAEGLWLPQLHVWDWLVFENMGAYTVGMGSLLGGAHTC
RITYAMSRVAWEALRGQLLPAEQDEDAEGTCRPLSCGWEITDTLCMGPVFTPASIM
Download sequence
Identical sequences ENSTTRP00000010326 ENSTTRP00000010326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]