SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010768 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000010768
Domain Number - Region: 219-259
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000929
Family Moesin tail domain 0.018
Further Details:      
 
Domain Number - Region: 125-198
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.03
Family NadC C-terminal domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010768   Gene: ENSTTRG00000011358   Transcript: ENSTTRT00000011357
Sequence length 714
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_149:18714:218681:1 gene:ENSTTRG00000011358 transcript:ENSTTRT00000011357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSPENSALEEILGQYQRSLRERASRSIHQLKCALREGDVTIGEDVMDPSFSTSVGNED
AGNAWHELQHSHAVNQLKALLCQQATKESEVSPRRRKLSPLKSSEYEETDMPALHNFVPI
ISDQSQYIHHLEAEVKFCKEELSGMKNRVQVIVLENERLQQELKSQRQEEAMREQTLLDA
SGNIQNSWITTGEDSRVDEAAKRSFSHGNADIIKAASTSEAEKWKLELERLKLTYEEKSK
ILESQLMFLRKDLVEYQKNCEDLKEQLKHKESLLAANISNRVGGLCLKCAQHEAVLSQTH
NNVHMQTIERLSKERDDLMSALVSVRSSLTEMQQREVSAYEQVKQAVKMTEEANFEKTKA
LIQCEQLKNELEKQTERLEKELASQRKRAFEKEMMKREITKEREDMGSKTLTLSQSIAQL
EAQVEKITREKISAVNQLEEIQNQLASREMDVTKVCGEMRYQLNKTKMEKDEAEKEHREY
RTKTKRDLEIKDQEIEKLSLELSESKQHLEQEQQKATRAREECLKLTELLGKSEHQLHLT
RLEKDSIQQSFSNDAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYSLLTSQNSFLTK
LKEECCTLAKKLEQISQKSRSEIAQLSQEKRYTCDKLEKLQRRNDELEEQCVQHGRLHEI
MKQRLKQLDKHSQATAQQLVQLLSKQNQLLLERQLTEEVGRLRSQLPSMPQSDC
Download sequence
Identical sequences ENSTTRP00000010768 ENSTTRP00000010768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]