SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010930 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010930
Domain Number 1 Region: 31-447
Classification Level Classification E-value
Superfamily ALDH-like 4.58e-84
Family ALDH-like 0.0000171
Further Details:      
 
Domain Number 2 Region: 501-548
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000154
Family ALDH-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010930   Gene: ENSTTRG00000011525   Transcript: ENSTTRT00000011525
Sequence length 564
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2942:64865:97913:-1 gene:ENSTTRG00000011525 transcript:ENSTTRT00000011525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLSPPALRRALLTRPWRAAGLCWKHVSSLKVANEPVLAFTQGSPEREALQKALKELKG
RTEAIPCVVGDEEVWTSDVRYQVSPFNHGHKVAKFCYADKALLHRAIEAALAARKEWDLK
PVADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVE
LEGEQPISVPPSTNSVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDAAM
LASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPXXXXXXXXXX
XXXXXXXXXXXXXXXCGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPRS
LWSQIKGRLLEERSRIKVGNPAEDFGSFFSAVIDAKSFSRIRKWLEHAHSSPSLTVLAGG
QCDDSVGYFVEPCIIESKDPQDPIMKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXAAGNFYINDKSTGSVVGQQPFGGARTSGTNDKPGGPHYIL
RWTSPQVIKETHKPLGDWRYPYMQ
Download sequence
Identical sequences ENSTTRP00000010930 ENSTTRP00000010930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]