SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010932 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010932
Domain Number 1 Region: 265-304
Classification Level Classification E-value
Superfamily Leucine zipper domain 3.83e-17
Family Leucine zipper domain 0.00025
Further Details:      
 
Domain Number 2 Region: 233-267
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 0.000000602
Family A DNA-binding domain in eukaryotic transcription factors 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010932   Gene: ENSTTRG00000011529   Transcript: ENSTTRT00000011528
Sequence length 321
Comment pep:known_by_projection scaffold:turTru1:scaffold_108632:13248:14343:1 gene:ENSTTRG00000011529 transcript:ENSTTRT00000011528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGGGGGGYSYGASLHSEPPVYANLSNISF
SSTVSASVVRFPHQLRTPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQ
ERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQ
KVMNHVNSGCQLMLTQQLQTF
Download sequence
Identical sequences ENSTTRP00000010932 ENSTTRP00000010932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]