SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011257 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011257
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Kringle-like 1.5e-25
Family Kringle modules 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011257   Gene: ENSTTRG00000011865   Transcript: ENSTTRT00000011867
Sequence length 431
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3074:361287:404884:1 gene:ENSTTRG00000011865 transcript:ENSTTRT00000011867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDV
SPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGASKTSNRLTIQTCISFC
RSQRFKFAGMESGYACFCGNSPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIIVFDXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLL
DGYTHRVVFNGRNRHLSFNISLDFVIYFSDRVSQAQGFAVYAVKEDPPQERPTANQTLAE
VFTEQANLSVSAARSSKVLYVITTSPSHPPQTMPGSSSQTPSKGGSHRVGGWTVYGLATL
LILTVTAVIAKMLLHITFKSHRVPALGDLRDCRQPGTSGEIWSIFYKPSTSISIFKKKLK
GQSQQDDRNPL
Download sequence
Identical sequences ENSTTRP00000011257 ENSTTRP00000011257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]