SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011285 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011285
Domain Number 1 Region: 349-400,432-561
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000011
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011285
Domain Number - Region: 588-659
Classification Level Classification E-value
Superfamily EF-hand 0.0786
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011285   Gene: ENSTTRG00000011895   Transcript: ENSTTRT00000011896
Sequence length 797
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3361:557252:592272:-1 gene:ENSTTRG00000011895 transcript:ENSTTRT00000011896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVQCPAGQELQKLGSGAWDNPAYIGAPSPRGTPRICTISSEVPPPSQPKKPEDGPQEK
AHKTLVSSCCLQICRGIRGLWGTTLTENTAENQELYVKTTLRELLVYMVFPVDICFLTYG
MTSSSAYYYTKVRSELFLHTPSDTGVSFQDISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GRGSHSFIYYENLLLGAPRLWQLRVRNDSVVHEDFHEDILSCHDVYSPDKEDLPFGLLSG
IATYHQDELGGSSHWGQLTSYSGGGYHLDLPGSRQASAEALRDLQEGLWPDRGSRVVFID
FSVYNANINLFCVLRLVVEFPATGGTIPSWQICTVKLIRCVGKWDFFIIGCEIIFCIFIF
YYVVEESLELHIHWLRYLSSIWNILDLVVILLSIVDVGFHIFRTLAVNRLMGKLLQQPNT
YADFEFLAFWQTQYNMNAVNLFFAWIKIFKYISFSKTMTQLSSTLARCAKDILGFAVMFF
IVFFAYAQLGYLLFGTQVESFNTFIKCIFTQFRIILGDFDYNAINNANRILGPAYFFTYV
FFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKALLRLHLRKEQVSDV
QKVLQGGEQKIQFEDFTNTLKELGHIEHEITELTAAFTRFDDGNHILDEKEQEEMRQDLE
EERVALTAETENLHRSSVSSPPGESSPEAAKAGGWVSGEEFYMLTRRVVQLEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXREQGIWEHLQAAPAVTPAPWGLQGGQESGFPCEREG
EAERTLSRGESTMLQRS
Download sequence
Identical sequences ENSTTRP00000011285 ENSTTRP00000011285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]