SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011340 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011340
Domain Number 1 Region: 184-258
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.27e-19
Family Middle domain of MutM-like DNA repair proteins 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011340
Domain Number - Region: 266-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011340   Gene: ENSTTRG00000011956   Transcript: ENSTTRT00000011956
Sequence length 323
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1447:228279:240747:1 gene:ENSTTRG00000011956 transcript:ENSTTRT00000011956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPSVRKFHHLVSPFVGQQVVKTGGSSKKLNPAGFQSLWLQDTQVHGKKLFVRFDPDE
EIVSPGNNPLSEPLQKEWKEEAGDHQEVSEQSSRFPGVPSGGDGLRCLWGDTPAGGAERW
LQVSFGLFGSVWGNEFSRAKKANKRGDWRDPVPRLVLHFGGGGFLFYNCRVGGSSSRVVR
PTSDILSEKFHRGQALEALCREQPVCYTLLDQRYFSGLGNIIKNEVLFKAGIHPLSPGSL
LGLPRLEALVDHVVAFSAGWLRGKFQGRQQHTQIYQKEWCPAGHQVVKEALGPPGGFQRL
TWWCPQCQPRLSLDEPEQVPPSS
Download sequence
Identical sequences ENSTTRP00000011340 ENSTTRP00000011340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]