SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011414 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011414
Domain Number 1 Region: 151-300
Classification Level Classification E-value
Superfamily TPR-like 1.1e-22
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 2 Region: 7-72,110-136
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000218
Family FKBP immunophilin/proline isomerase 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011414   Gene: ENSTTRG00000012039   Transcript: ENSTTRT00000012036
Sequence length 314
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1206:18770:26743:-1 gene:ENSTTRG00000012039 transcript:ENSTTRT00000012036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GELPNFITGARVTFHFRTLKCDDERTVIDDSKQVGHPMHIIIGNMFKLEVWEILLTSMRF
SEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQ
KEPQPLIFVIELLQVEAPSEYQRETWNLSKDEKMQAVPILHGEGNRLFKLGRYEEASTKY
QEAIVCLRNLQIKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHP
GIAKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRKVVRRELSLLENRMEEKREEERL
RCRNMLRCAGARPP
Download sequence
Identical sequences ENSTTRP00000011414 ENSTTRP00000011414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]