SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011467 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011467
Domain Number 1 Region: 167-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-80
Family Eukaryotic proteases 0.00000000538
Further Details:      
 
Domain Number 2 Region: 51-162
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-33
Family Kringle modules 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011467   Gene: ENSTTRG00000012091   Transcript: ENSTTRT00000012091
Sequence length 431
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2911:182720:187200:1 gene:ENSTTRG00000012091 transcript:ENSTTRT00000012091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLACLLLCALVVRDSEGSHELHQVSGASKCGCLNGGKCVSYKYFSNIQRCDCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANTDTSGRPCLAWNSPTILLKTYHAHRPDALQLGLGK
HNYCRNPDNQRRPWCYVHVGLMQVVQECMVHSCSSERNALSPPEKLQCGQKALRPRFKIV
GGEFTTIENQPWFAAIYRRHRAGSVTYVCGGSLINPCWVVSATHCFIEYQRKEDYIVYLG
RSKLNSITPGEMQFEVQKLILHKDYSADTLAHHNDIALLKIRSSTGQCAQPSRSIQVICL
PPANGDARFGTSCEVTGFGKENPSDYIYPEQLKMTTVKLVSHEECQQPHYYGAEVTSKML
CAADPQWETDSCQGDSGGPLVCFTQGRMTLTGIVSWGRECAMKEKPGVYTRVSSFLPWIH
THIGGENGLAL
Download sequence
Identical sequences XP_019791577.1.83887 XP_019791578.1.83887 XP_019791579.1.83887 ENSTTRP00000011467 ENSTTRP00000011467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]