SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011474 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011474
Domain Number 1 Region: 416-529,649-786
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.54e-68
Family Phosphate binding protein-like 0.000000149
Further Details:      
 
Domain Number 2 Region: 20-397
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.07e-44
Family L-arabinose binding protein-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011474   Gene: ENSTTRG00000012094   Transcript: ENSTTRT00000012099
Sequence length 957
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1903:57595:375092:1 gene:ENSTTRG00000012094 transcript:ENSTTRT00000012099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVWAPLVLLPTWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQFQRFTTLNLHPSSTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVMAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVADGLSMDSRLYASNVSDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYTPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVS
VCQEMVSELRSIILCQDSVHPRRRRAGLPPPQPPIPEEQRRPRGTVTLSNGKLCGAGEPD
QLAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Download sequence
Identical sequences ENSTTRP00000011474 ENSTTRP00000011474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]