SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011485 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011485
Domain Number 1 Region: 516-669
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.11e-46
Family Hemopexin-like domain 0.000000384
Further Details:      
 
Domain Number 2 Region: 90-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.17e-32
Family Matrix metalloproteases, catalytic domain 0.000000825
Further Details:      
 
Domain Number 3 Region: 337-390
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 1.63e-20
Family Fibronectin type II module 0.00013
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-20
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 6 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 2.67e-18
Family MMP N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011485   Gene: ENSTTRG00000012110   Transcript: ENSTTRT00000012110
Sequence length 670
Comment pep:known_by_projection scaffold:turTru1:scaffold_96259:65202:71241:1 gene:ENSTTRG00000012110 transcript:ENSTTRT00000012110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPWQPLVLALLVLGCCSAAPRPHQPTFVVFPGELRSSLTDRQLAEDYLYRYGYTNVAEI
SKDDQSLRQPLQRLQRRLALPETGELDSTTLNAMRAPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYP
FDGKNGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNAKGAACHFPFTFEGRS
YSACTTDGRSDDMLWCSTTADYDTDRQFGFCPSERLYTQDGNADGKPCVFPFTFESRSYS
ACTTDGRSDGYRWCATTASYDQDKLYGFCPTRADATVTEGNSAGELCVFPFTFLGKEYST
CTREGRRDGQLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSFTEKHPLHKDDVQGIQHLYGPRPEPEPRPPTTATAEPQPTAPPTVCATGPPTAPPS
ERPTAGPTGPPSAGPTGPPTAGPSAIPTRSLDPADDVCNVNIFDAIAEIGKRLHLFKDGR
YWRLSESGGRPLQGPFFIKNTWPALPLKLDSAFEDPLTKKIFFFSGRQVWVYTGSSVLGP
RRLDKLGLGPEVAQVTGALPRAGGKVLLFSRQSFWRFDVKTQKVDPQSATPVDQMFPGVP
MNTHDIFQYQ
Download sequence
Identical sequences ENSTTRP00000011485 ENSTTRP00000011485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]