SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011514 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011514
Domain Number 1 Region: 168-465
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.33e-41
Family NadC C-terminal domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011514
Domain Number - Region: 37-54,94-133
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0141
Family NadC N-terminal domain-like 0.017
Further Details:      
 
Domain Number - Region: 67-99
Classification Level Classification E-value
Superfamily DUSP-like 0.0889
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011514   Gene: ENSTTRG00000012148   Transcript: ENSTTRT00000012144
Sequence length 472
Comment pep:novel scaffold:turTru1:scaffold_110581:176365:204147:1 gene:ENSTTRG00000012148 transcript:ENSTTRT00000012144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHYKQYPPNTSKVYSYFECREKKTENSKIRKVKYEETVFYGLQYILNKYLKGKVVTKEK
IQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEVKAVPEGSVIPRGNVLFTVENTDP
ECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVS
SQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTEAPLIIRPDSGNPLD
TVLKVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKKWSIENVS
FGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGN
FVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNAQLNIELEATPH
Download sequence
Identical sequences ENSTTRP00000011514 ENSTTRP00000011514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]