SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011626 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011626
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000275
Family Cgl1923-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011626   Gene: ENSTTRG00000012256   Transcript: ENSTTRT00000012257
Sequence length 264
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_543:85847:103212:1 gene:ENSTTRG00000012256 transcript:ENSTTRT00000012257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGDSVPDLAGCTLLMPAVSVGNVGQLAIDLIISTLNMYKIGYFYTDCLVPMVGNNP
YATAEENSTELSINAEVYASPSKKLVALQLRSIFIKYKSKSFCEKLLFWVKSSNCAKVVV
LSSSHSYHRNDFQLRSTPFRYLLTPSTKKSVQNKIQSLNWEEMEKSPCIPEIDDSEFCVR
IPGGGITKTLYDEGCSKEIPMVILLKFVSEGDNIPDALGLVEYLNEWLQIIKPCCDDPSA
SALPWKMPSSWRLLFGSGLPPALF
Download sequence
Identical sequences XP_004276020.1.21590 XP_004320425.1.83887 ENSTTRP00000011626 ENSTTRP00000011626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]