SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011858 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011858
Domain Number 1 Region: 928-1264
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 7.19e-115
Family Methionine synthase SAM-binding domain 0.0000000498
Further Details:      
 
Domain Number 2 Region: 23-155,204-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.57e-91
Family Homocysteine S-methyltransferase 0.0000564
Further Details:      
 
Domain Number 3 Region: 371-507
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.24e-44
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0022
Further Details:      
 
Domain Number 4 Region: 769-921
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.7e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000273
Further Details:      
 
Domain Number 5 Region: 665-754
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.96e-25
Family Methionine synthase domain 0.0000442
Further Details:      
 
Domain Number 6 Region: 567-645
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 4.32e-18
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011858   Gene: ENSTTRG00000012480   Transcript: ENSTTRT00000012497
Sequence length 1265
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3162:385068:526349:1 gene:ENSTTRG00000012480 transcript:ENSTTRT00000012497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALHDLTPSAGMKKTLQDEIDAILRERIMVLDGGMGTMIQRHKLSEDDFRGQEFKNHA
RPLKGNNDILSITQPDVIYQIHKDYLLAGADIIETNTFSSTAIAQADYGLEHLAYRMNKC
SAGVARKAAEEITLQTGIKRYVAGALGPTNKTLSVSPSVERPDYRNIXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAALFAVHKLFEEEYAPRPILISGTIVDKSGRTLSGQT
GEAFVISVSHADPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGEYDET
PHVMAMHLKDFAMDGLVNIVGGCCGTTPDHIREIAETVKNYKPRVPPATVFEGHMLLSGL
EPFRIGPHTNFVNIGERCNVAGSRKFAKLIMTGNYEEALSVAKMQVEMGAQVLDINMDDG
MLDGPSAMTRFCNFIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKFGAAVVVMAFDEEGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXETLPGARVSGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKFGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNRDPEATEKLLHYAQTQGKGGKKV
IQTDEWRNGPIEERLAYALVKGIEKYIIEDTEEARLNQEKYPRPLNIIEGPLMSGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLILFMEKEREETKVLPGTIEDKDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEIMEEYEDIRQDHYESLKERRYLTLRQARESGFHIDWLSEPPPVKPTFLGTRV
FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFDDKAVGEEAKKVYDDAQNMLQAL
ISQKQLHARGVVGFWPAQSSQDDIHLYAEGAAPQAVEPIATFYGLRQQAEKDSASADPYL
CLSDFIAPLHSGVPDYLGLFAVACFGVEELSKAYEEECDDYSSIMVKALGDRLAEAFAEE
LHVRVRRELWGYCGGEQLAVADLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLADVERHTG
IRLTESLAMAPASAVSGLYFSNLRSRYFAVGKISKDQIEDYALRKSMSVAEVEKWLGPIL
GYDTE
Download sequence
Identical sequences ENSTTRP00000011858 ENSTTRP00000011858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]