SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011872 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011872
Domain Number 1 Region: 17-137
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.75e-24
Family Chaperone J-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011872   Gene: ENSTTRG00000012513   Transcript: ENSTTRT00000012513
Sequence length 190
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1519:75222:76756:1 gene:ENSTTRG00000012513 transcript:ENSTTRT00000012513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVDKAARPLSKTGSTLYAVLELKKGASPEDVKKAYSHSSSPHPPGYCLGRRLALKYHP
DKNPGDPQAAEIFKEINTAHSVLSDPKKRQIYDRHGSLGIYIYDHFGEEGVTYYFTLNSC
WFKTLVLLCALLTCCCCCCCCCCFCWGTLKPPPEEAAKKKYEPNVQNQPPRPGHREHFRR
GEDNSSGDNY
Download sequence
Identical sequences ENSTTRP00000011872 ENSTTRP00000011872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]