SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011923 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011923
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000000000036
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.000000000144
Family UBC-related 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011923   Gene: ENSTTRG00000012566   Transcript: ENSTTRT00000012566
Sequence length 397
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_318:292203:329308:1 gene:ENSTTRG00000012566 transcript:ENSTTRT00000012566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLVDKQGVYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPALAPASTAFPYLYSKAGGTPPCASPGFPFLPPYPPQEATRTVSSLSVADTVS
SSATSHTAAKPAAPSFGVLSNLPLPVPTTDTSAPISQNGFGYKMPDIPDVFPELSELSVS
QLTDMNDQEEVLLEQFLTLPQLKQIITDKDDLMKSIEELARKNLLLEPSLEAKRQTVLDK
YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEDSDNIAEDFLEGKTDID
DFLSSFMEKRTICHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences ENSTTRP00000011923 ENSTTRP00000011923 XP_004277222.1.21590 XP_019776867.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]