SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011933 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011933
Domain Number 1 Region: 348-531,644-863,893-923
Classification Level Classification E-value
Superfamily Ras GEF 4.45e-103
Family Ras GEF 0.00062
Further Details:      
 
Domain Number 2 Region: 97-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-29
Family DEP domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 552-653
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-26
Family Ras-binding domain, RBD 0.0075
Further Details:      
 
Domain Number 4 Region: 221-350
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-25
Family cAMP-binding domain 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011933   Gene: ENSTTRG00000012575   Transcript: ENSTTRT00000012576
Sequence length 923
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_17:263339:284722:-1 gene:ENSTTRG00000012575 transcript:ENSTTRT00000012576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVSWPGESRWQVGLAVEDSSVLGAPPVGGLPDVVPEGTLFNMVLRRMHRSRSCSYQLLL
EHQRPSCIQGLRWTPLANSEESLDFSVSLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLHRQCCSGRELVDGILALGLGVHSRSQAVGICQVLLDEGALCHVKHDWAFQDRDTQ
FYRFPGPEPEPAGLHELEEELVEALALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTVHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERTSQGTGPSRPPTPGRNRYIVMSGTPEKILELLLEAMRPDSSAHDPTETFLSD
FLLTHSVFMPTAQLCAALLHHFHAEPMGGSEQECSTYICNKRQQILRLVSQWVALYGPML
HTDPVATSFLQKLSDLVSRDARLCNLLREQWPERRRHHRLENGCGNASPQMKARNMPVWL
PSQDEPLPSSNCAIRVGDKVPYDICRLDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDTVGLQPDAHGVATSLGLNERLFVVNPQEVHKLTPHPEQLGPTVGSAEGLDL
VSTKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQPLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGLRAQLLRKFIKLAAHLKEQKNLNSFFAIMFGLSNSAISRLAQTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALTKLSPPLIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHSNVPLSPLRSRVSHLHEDSQAARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences ENSTTRP00000011933 ENSTTRP00000011933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]